제품 > 항체 > 다중클론항체(pAb)

GALNT7 Rabbit pAb (A20259)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using GALNT7 Rabbit pAb (A20259) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

ABclonal:Immunohistochemistry - GALNT7 Rabbit pAb (A20259)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using GALNT7 Rabbit pAb (A20259) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	GALNT7 Rabbit pAb
Catalog No.	A20259
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes GalNAc transferase 7, a member of the GalNAc-transferase family. The enzyme encoded by this gene controls the initiation step of mucin-type O-linked protein glycosylation and transfer of N-acetylgalactosamine to serine and threonine amino acid residues. This enzyme is a type II transmembrane protein and shares common sequence motifs with other family members. Unlike other family members, this enzyme shows exclusive specificity for partially GalNAc-glycosylated acceptor substrates and shows no activity with non-glycosylated peptides. This protein may function as a follow-up enzyme in the initiation step of O-glycosylation.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 30-130 of human GALNT7 (NP_059119.2).
Sequence	PRPDDPSPLSRMREDRDVNDPMPNRGGNGLAPGEDRFKPVVPWPHVEGVEVDLESIRRINKAKNEQEHHAGGDSQKDIMQRQYLTFKPQTFTYHDPVLRPG
Gene ID
Swiss Prot
Synonyms	GalNAcT7; GALNAC-T7; GALNT7
Calculated MW	75kDa
Observed MW	70kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, HT-29
Cellular location	extracellular exosome, Golgi apparatus.