제품 > 항체 > 단일클론항체(mAb)

GC1q R/C1QBP Rabbit mAb (A11292)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using GC1q R/C1QBP Rabbit mAb (A11292) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - GC1q R/C1QBP Rabbit mAb (A11292)

Immunohistochemistry analysis of GC1q R/C1QBP in paraffin-embedded human thyroid cancer tissue using GC1q R/C1QBP Rabbit mAb (A11292) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of GC1q R/C1QBP in paraffin-embedded human liver tissue using GC1q R/C1QBP Rabbit mAb (A11292) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of GC1q R/C1QBP in paraffin-embedded human colon carcinoma tissue using GC1q R/C1QBP Rabbit mAb (A11292) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of GC1q R/C1QBP in paraffin-embedded rat kidney tissue using GC1q R/C1QBP Rabbit mAb (A11292) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of GC1q R/C1QBP in paraffin-embedded human colon tissue using GC1q R/C1QBP Rabbit mAb (A11292) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of GC1q R/C1QBP in paraffin-embedded mouse kidney tissue using GC1q R/C1QBP Rabbit mAb (A11292) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	GC1q R/C1QBP Rabbit mAb
Catalog No.	A11292
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2753

Background

The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human GC1q R/C1QBP (Q07021).
Sequence	KTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAE
Gene ID
Swiss Prot
Synonyms	p32; HABP1; gC1qR; GC1QBP; SF2p32; gC1Q-R; COXPD33; SF2AP32; GC1q R/C1QBP
Calculated MW	31kDa
Observed MW	33kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, HCT116, SW620, 293T, C2C12, Mouse ovary, Mouse pancreas, Rat brain, Rat heart
Cellular location	Cell membrane, Cytoplasm, Extracellular side, Mitochondrion matrix, Nucleus, Peripheral membrane protein, Secreted, nucleolus