제품 > 항체 > 다중클론항체(pAb)

GC1q R/C1QBP Rabbit pAb (A1883)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using GC1q R/C1QBP Rabbit pAb (A1883) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - GC1q R/C1QBP Rabbit pAb (A1883)

Immunofluorescence analysis of HeLa cells using GC1q R/C1QBP Rabbit pAb (A1883). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review

Overview

Product name	GC1q R/C1QBP Rabbit pAb
Catalog No.	A1883
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 74-282 of human GC1q R/GC1q R/C1QBP (NP_001203.1).
Sequence	LHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
Gene ID
Swiss Prot
Synonyms	p32; HABP1; gC1qR; GC1QBP; SF2p32; gC1Q-R; COXPD33; SF2AP32; GC1q R/C1QBP
Calculated MW	31kDa
Observed MW	36kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	CEM, SW620, HeLa, Jurkat, Mouse liver, Mouse kidney, Mouse heart, Mouse intestine, Rat brain
Cellular location	Cell membrane, Cytoplasm, Extracellular side, Mitochondrion matrix, Nucleus, Peripheral membrane protein, Secreted, nucleolus
Customer validation	(HeLa) ELISA(Homo sapiens) WB(Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

GC1q R/C1QBP Rabbit pAb images

Western blot - GC1q R/C1QBP Rabbit pAb (A1883)

Immunofluorescence - GC1q R/C1QBP Rabbit pAb (A1883)

Immunofluorescence analysis of HeLa cells using GC1q R/C1QBP Rabbit pAb (A1883). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.