제품 > 항체 > 다중클론항체(pAb)

GLOD4 Rabbit pAb (A9216)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using GLOD4 Rabbit pAb (A9216) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	GLOD4 Rabbit pAb
Catalog No.	A9216
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables cadherin binding activity. Located in extracellular exosome.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 179-298 of human GLOD4 (NP_057164.3).
Sequence	DNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMAADKSDEWFAKHNKPKASG
Gene ID
Swiss Prot
Synonyms	HC6; HC71; CGI-150; C17orf25; GLOD4
Calculated MW	35kDa
Observed MW	30-37kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-87MG, 293T, HepG2, Mouse brain, Mouse kidney
Cellular location	Mitochondrion