제품 > 항체 > 단일클론항체(mAb)

GM-CSF Rabbit mAb (A25503)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity: Rat

Western blot analysis of recombinant Rat GM-CSF Protein using GM-CSF Rabbit mAb (A25503) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 5 ng/1 ng/0.1 ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

Overview

Product name	GM-CSF Rabbit mAb
Catalog No.	A25503
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64162

Background

Enables cytokine activity. Involved in several processes, including cellular response to lipopolysaccharide; macrophage activation; and response to silicon dioxide. Located in extracellular space. Used to study Parkinsonism and myocardial infarction. Biomarker of abdominal aortic aneurysm; interstitial cystitis; and lung disease (multiple). Human ortholog(s) of this gene implicated in acute myeloid leukemia; juvenile myelomonocytic leukemia; neutropenia; pulmonary alveolar proteinosis; and visceral leishmaniasis. Orthologous to human CSF2 (colony stimulating factor 2).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-144 of rat GM-CSF (NP_446304.1).
Sequence	TRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK
Gene ID
Swiss Prot
Synonyms	Gmcsf; Gm-csf
Calculated MW	17kDa
Observed MW	45-60kDa

Applications

Reactivity	Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Recombinant Rat GM-CSF Protein
Cellular location	Secreted.