제품 > 항체 > 단일클론항체(mAb)

GOLPH2 Rabbit PolymAb® (A26409PM)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using GOLPH2 Rabbit PolymAb® (A26409PM) at 1:3000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - GOLPH2 Rabbit PolymAb® (A26409PM)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using GOLPH2 Rabbit PolymAb® (A26409PM) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using GOLPH2 Rabbit PolymAb® (A26409PM) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using GOLPH2 Rabbit PolymAb® (A26409PM) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using GOLPH2 Rabbit PolymAb® (A26409PM) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using GOLPH2 Rabbit PolymAb® (A26409PM) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - GOLPH2 Rabbit PolymAb® (A26409PM)

Confocal imaging of HeLa cells using GOLPH2 Rabbit PolymAb® (A26409PM, dilution 1:2000) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of A-431 cells using GOLPH2 Rabbit PolymAb® (A26409PM, dilution 1:2000) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of paraffin-embedded Mouse colon tissue using GOLPH2 Rabbit PolymAb® (A26409PM, dilution 1:2000) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Overview

Product name	GOLPH2 Rabbit PolymAb®
Catalog No.	A26409PM
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human GOLPH2. (NP_057632.2).
Sequence	VEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDD
Gene ID
Swiss Prot
Synonyms	GP73; HEL46; GOLPH2; C9orf155; PSEC0257; bA379P1.3
Calculated MW	45kDa
Observed MW	80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:3000 IHC-P 1:5000 - 1:20000 IF/ICC 1:1000 - 1:4000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse lung, Mouse spleen
Cellular location	Golgi apparatus, Single-pass type II membrane protein, cis-Golgi network membrane.