제품 > 항체 > 다중클론항체(pAb)

GPR35 Rabbit pAb (A17953)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of various lysates using GPR35 Rabbit pAb (A17953) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	GPR35 Rabbit pAb
Catalog No.	A17953
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables C-X-C chemokine receptor activity. Involved in several processes, including chemokine-mediated signaling pathway; negative regulation of voltage-gated calcium channel activity; and positive regulation of cytosolic calcium ion concentration. Is integral component of plasma membrane.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human GPR35 (NP_005292.2).
Sequence	QQWTETRIYMTNLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVLWVLVIGSLVA
Gene ID
Swiss Prot
Synonyms	GPR35
Calculated MW	34kDa
Observed MW	34kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse brain, mouse stomach, mouse liver
Cellular location	plasma membrane
Customer validation	WB(Mus musculus)