제품 > 항체 > 단일클론항체(mAb)

Glucagon Rabbit mAb (A23029)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Immunohistochemistry analysis of paraffin-embedded Human pancreas using Glucagon Rabbit mAb (A23029) at dilution of 1:2500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - Glucagon Rabbit mAb (A23029)

Immunofluorescence analysis of paraffin-embedded mouse pancreas using Glucagon Rabbit mAb (A23029) at dilution of 1:500 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunofluorescence analysis of paraffin-embedded rat pancreas using Glucagon Rabbit mAb (A23029) at dilution of 1:500 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Overview

Product name	Glucagon Rabbit mAb
Catalog No.	A23029
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC56936

Background

The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Glucagon (NP_002045.1).
Sequence	MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAE
Gene ID
Swiss Prot
Synonyms	GLP1; GLP2; GRPP; GLP-1; Glucagon
Calculated MW	21kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:1000 - 1:5000 IF/ICC 1:100 - 1:500 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Immunohistochemistry Immunofluorescence
Positive samples
Cellular location	Secreted.