Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Glycogen synthase 1 (GYS1) Rabbit mAb |
---|---|
Catalog No. | A8912 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1350 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 638-737 of human Glycogen synthase (P13807). |
---|---|
Sequence | RPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN |
Gene ID | |
Swiss Prot | |
Synonyms | GSY; GYS; Glycogen synthase 1 (GYS1) |
Calculated MW | 84kDa |
Observed MW | 85kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, 293T, RD, Mouse brain, Rat heart |
Cellular location | cytoplasm, cytosol. |
Customer validation | WB(Homo sapiens) IF(Mus musculus) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A8912? Please let us know so that we can cite the reference in this datasheet.