Review (1)Publications (9) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | HDAC2 Rabbit mAb |
---|---|
Catalog No. | A19626 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2647 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC2 (NP_001518.3). |
---|---|
Sequence | MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGED |
Gene ID | |
Swiss Prot | |
Synonyms | HD2; RPD3; YAF1; KDAC2; HDAC2 |
Calculated MW | 55kDa |
Observed MW | 60kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | HeLa, 293T, NIH/3T3, C6, Mouse liver |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | (HT29、SNB-19、A549、PC-3、Ramos、U87-MG) WB(Mus musculus, Homo sapiens, Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A19626? Please let us know so that we can cite the reference in this datasheet.