제품 > 항체 > 다중클론항체(pAb)

SIRT2 Rabbit pAb (A14109)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of extracts of various cell lines, using SIRT2 antibody (A14109) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	SIRT2 Rabbit pAb
Catalog No.	A14109
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Several transcript variants are resulted from alternative splicing of this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 300-350 of human SIRT2 (NP_036369.2).
Sequence	IMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHA
Gene ID
Swiss Prot
Synonyms	SIR2; SIR2L; SIR2L2
Calculated MW	43kDa
Observed MW	39kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse brain, Mouse spinal cord, Rat brain, Rat spinal cord
Cellular location	Cell projection, Chromosome, Cytoplasm, Midbody, Myelin membrane, Nucleus, Perikaryon, centriole, centrosome, cytoskeleton, growth cone, microtubule organizing center, perinuclear region, spindle