Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | SIRT2 Rabbit mAb |
---|---|
Catalog No. | A3967 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2644 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SIRT2 (Q8IXJ6). |
---|---|
Sequence | MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPS |
Gene ID | |
Swiss Prot | |
Synonyms | SIR2; SIR2L; SIR2L2; SIRT2 |
Calculated MW | 43kDa |
Observed MW | 43kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, 293T, HepG2 |
Cellular location | centriole, centrosome, cytoplasm, cytosol, glial cell projection, growth cone, lateral loop, meiotic spindle, mitochondrion, mitotic spindle, myelin sheath, nucleolus, nucleus, paranodal junction, perikaryon, perinuclear region of cytoplasm, plasma membrane, spindle. |
Customer validation | WB(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3967? Please let us know so that we can cite the reference in this datasheet.