제품 > 항체 > 단일클론항체(mAb)

SIRT2 Rabbit mAb (A25817)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SIRT2 Rabbit mAb (A25817) at 1:6400 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - SIRT2 Rabbit mAb (A25817)

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using SIRT2 Rabbit mAb (A25817) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using SIRT2 Rabbit mAb (A25817) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human brain tissue using SIRT2 Rabbit mAb (A25817) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	SIRT2 Rabbit mAb
Catalog No.	A25817
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64037

Background

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Several transcript variants are resulted from alternative splicing of this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 281-380 of human SIRT2 (NP_036369.2).
Sequence	PRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGVPNPSTSASPKKSPPPAKDEA
Gene ID
Swiss Prot
Synonyms	SIR2; SIR2L; SIR2L2
Calculated MW	43kDa
Observed MW	39kDa/43kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:6000 - 1:24000 IHC-P 1:4000 - 1:20000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, 293T, Mouse brain
Cellular location	Cell projection, Chromosome, Cytoplasm, Midbody, Myelin membrane, Nucleus, Perikaryon, centriole, centrosome, cytoskeleton, growth cone, microtubule organizing center, perinuclear region, spindle, cytoplasm, cytosol, glial cell projection, lateral loop, meiotic spindle, mitochondrion, mitotic spindle, myelin sheath, nucleolus, nucleus, paranodal junction, perikaryon, perinuclear region of cytoplasm, plasma membrane.