제품 > 항체 > 단일클론항체(mAb)

HE4/WFDC2 Rabbit mAb (A3276)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using HE4/WFDC2 Rabbit mAb (A3276) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunofluorescence - HE4/WFDC2 Rabbit mAb (A3276)

Immunofluorescence analysis of NIH-3T3 cells using HE4/WFDC2 Rabbit mAb (A3276) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using HE4/WFDC2 Rabbit mAb (A3276) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	HE4/WFDC2 Rabbit mAb
Catalog No.	A3276
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1936

Background

This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 45-124 of human HE4/WFDC2 (Q14508).
Sequence	CTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Gene ID
Swiss Prot
Synonyms	HE4; WAP5; EDDM4; dJ461P17.6
Calculated MW	13kDa
Observed MW	22kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, HT-29, SKOV3, Mouse liver, Mouse kidney
Cellular location	Secreted
Customer validation	WB(Homo sapiens, Mus musculus) IHC(Homo sapiens, Mus musculus)