제품 > 항체 > 다중클론항체(pAb)

HE4/WFDC2 Rabbit pAb (A6788)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of OVCAR3 cells, using HE4/WFDC2 antibody (A6788) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunofluorescence - HE4/WFDC2 Rabbit pAb (A6788)

Immunofluorescence analysis of MCF7 cells using HE4/WFDC2 Rabbit pAb (A6788) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	HE4/WFDC2 Rabbit pAb
Catalog No.	A6788
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 31-124 of human HE4/WFDC2 (NP_006094.3).
Sequence	EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Gene ID
Swiss Prot
Synonyms	HE4; WAP5; EDDM4; dJ461P17.6
Calculated MW	13kDa
Observed MW	20kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	OVCAR3
Cellular location	Secreted