제품 > 항체 > 다중클론항체(pAb)

HES1 Rabbit pAb (A11705)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Rat, Mouse

Western blot analysis of lysates from Mouse eye using HES1 Rabbit pAb (A11705) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 1 s.

Overview

Product name	HES1 Rabbit pAb
Catalog No.	A11705
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 151-280 of human HES1 (NP_005515.1).
Sequence	NAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
Gene ID
Swiss Prot
Synonyms	HHL; HRY; HES-1; bHLHb39; HES1
Calculated MW	30kDa
Observed MW	30kDa

Applications

Reactivity	Rat, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse eye
Cellular location	Nucleus.
Customer validation	IHC(Mus musculus)