제품 > 항체 > 단일클론항체(mAb)

HES5 Rabbit mAb (A9768)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using HES5 Rabbit mAb (A9768) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - HES5 Rabbit mAb (A9768)

Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using HES5 Rabbit mAb (A9768) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Overview

Product name	HES5 Rabbit mAb
Catalog No.	A9768
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1740

Background

This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 12-142 of human HES5 (Q5TA89).
Sequence	SPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPP
Gene ID
Swiss Prot
Synonyms	bHLHb38; HES5
Calculated MW	18kDa
Observed MW	18kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:100 - 1:500 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse brain, Mouse spleen, Rat brain, Rat spleen
Cellular location	Nucleus.
Customer validation	WB(Rattus norvegicus)