제품 > 항체 > 다중클론항체(pAb)

HP1 alpha/CBX5 Rabbit pAb (A1098)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using HP1 alpha/CBX5 Rabbit pAb (A1098) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunohistochemistry - HP1 alpha/CBX5 Rabbit pAb (A1098)

Immunohistochemistry analysis of paraffin-embedded Rat hippocampus using HP1 alpha/CBX5 Rabbit pAb (A1098) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human brain astrocytoma using HP1 alpha/CBX5 Rabbit pAb (A1098) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney using HP1 alpha/CBX5 Rabbit pAb (A1098) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

ABclonal:Immunofluorescence - HP1 alpha/CBX5 Rabbit pAb (A1098)

Immunofluorescence analysis of HeLa cells using HP1 alpha/CBX5 Rabbit pAb (A1098). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - HP1 alpha/CBX5 Rabbit pAb (A1098)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 1 μg HP1 alpha/HP1 alpha/CBX5 antibody (A1098). Western blot was performed from the immunoprecipitate using HP1 alpha/HP1 alpha/CBX5 antibody (A1098) at a dilution of 1:1000.

Overview

Product name	HP1 alpha/CBX5 Rabbit pAb
Catalog No.	A1098
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-191 of human HP1 alpha/HP1 alpha/CBX5 (NP_001120794.1).
Sequence	MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
Gene ID
Swiss Prot
Synonyms	HP1; HP1A; HEL25; HP1 alpha/CBX5
Calculated MW	22kDa
Observed MW	22kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 1:20 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HeLa, MCF7, A-549, SH-SY5Y
Cellular location	Chromosome, Nucleus, centromere.
Customer validation	WB(Homo sapiens)