제품 > 항체 > 다중클론항체(pAb)

HPCAL1 Rabbit pAb (A21455)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using HPCAL1 Rabbit pAb (A21455) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunoprecipitation - HPCAL1 Rabbit pAb (A21455)

Immunoprecipitation analysis of extracts of HepG2 cells using HPCAL1 antibody (A21455). Western blot was performed from the immunoprecipitate using HPCAL1 antibody (A21455) at a dilution of 1:1000.

Overview

Product name	HPCAL1 Rabbit pAb
Catalog No.	A21455
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. It is highly similar to human hippocalcin protein and nearly identical to the rat and mouse hippocalcin like-1 proteins. It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation and may be of relevance for neuronal signalling in the central nervous system. Several alternatively spliced transcript variants encoding the same protein have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human HPCAL1 (NP_002140.2).
Sequence	MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF
Gene ID
Swiss Prot
Synonyms	BDR1; HLP2; VILIP-3; HPCAL1
Calculated MW	22kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples
Cellular location	Lipid-anchor, Membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구신경 과학칼슘 신호전달

HPCAL1 Rabbit pAb images

Western blot - HPCAL1 Rabbit pAb (A21455)

Immunoprecipitation - HPCAL1 Rabbit pAb (A21455)

Immunoprecipitation analysis of extracts of HepG2 cells using HPCAL1 antibody (A21455). Western blot was performed from the immunoprecipitate using HPCAL1 antibody (A21455) at a dilution of 1:1000.

* For research use only. Not for therapeutic or diagnostic purposes.