제품 > 항체 > 단일클론항체(mAb)

HSF1 Rabbit mAb (A23895)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from HeLa cells, using HSF1 Rabbit mAb (A23895) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - HSF1 Rabbit mAb (A23895)

Immunohistochemistry analysis of paraffin-embedded Human brain using HSF1 Rabbit mAb (A23895) at dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human cervix cancer using HSF1 Rabbit mAb (A23895) at dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using HSF1 Rabbit mAb (A23895) at dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human kidney using HSF1 Rabbit mAb (A23895) at dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis using HSF1 Rabbit mAb (A23895) at dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunoprecipitation - HSF1 Rabbit mAb (A23895)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg HSF1 Rabbit mAb (A23895). Western blot was performed from the immunoprecipitate using HSF1 Rabbit mAb (A23895) at a dilition of 1:2000.

Overview

Product name	HSF1 Rabbit mAb
Catalog No.	A23895
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61341

Background

The product of this gene is a transcription factor that is rapidly induced after temperature stress and binds heat shock promoter elements (HSE). This protein plays a role in the regulation of lifespan. Expression of this gene is repressed by phosphorylation, which promotes binding by heat shock protein 90.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 429-530 of human HSF1( NP_005517.1).
Sequence	PDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS
Gene ID
Swiss Prot
Synonyms	HSTF1; HSF1
Calculated MW	57kDa
Observed MW	75kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 IHC-P 1:200 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa
Cellular location	Cytoplasm, Nucleus.