제품 > 항체 > 다중클론항체(pAb)

HSF1 Rabbit pAb (A13765)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using HSF1 Rabbit pAb (A13765) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - HSF1 Rabbit pAb (A13765)

Immunohistochemistry analysis of paraffin-embedded rat spleen using HSF1 Rabbit pAb (A13765) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - HSF1 Rabbit pAb (A13765)

Immunofluorescence analysis of C6 cells using HSF1 Rabbit pAb (A13765) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using HSF1 Rabbit pAb (A13765) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using HSF1 Rabbit pAb (A13765) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	HSF1 Rabbit pAb
Catalog No.	A13765
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The product of this gene is a transcription factor that is rapidly induced after temperature stress and binds heat shock promoter elements (HSE). This protein plays a role in the regulation of lifespan. Expression of this gene is repressed by phosphorylation, which promotes binding by heat shock protein 90.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 350-529 of human HSF1 (NP_005517.1).
Sequence	DARGHTDTEGRPPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS
Gene ID
Swiss Prot
Synonyms	HSTF1; HSF1
Calculated MW	57kDa
Observed MW	90kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:100 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, K-562, HepG2, MCF7
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Mus musculus, Homo sapiens, Rattus norvegicus)