제품 > 항체 > 단일클론항체(mAb)

HSP40 Rabbit mAb (A23957)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using HSP40 Rabbit mAb (A23957) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

ABclonal:Flow CytoMetry - HSP40 Rabbit mAb (A23957)

Flow cytometry: 1X10^6 293T-HSP40-shRNA-1 cells (pink line)、293T-HSP40-shRNA-2 cells (green line) and 293T-scramble cells (orange line) were intracellularly-stained with HSP40 Rabbit mAb (A23957, 2μg/mL) or ABflo® 647 Rabbit IgG isotype control (A22070, 2μg/mL, blue line) , followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining.Non-fluorescently stained cells were used as blank control (red line).

Overview

Product name	HSP40 Rabbit mAb
Catalog No.	A23957
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62654

Background

This gene encodes a member of the DnaJ or Hsp40 (heat shock protein 40 kD) family of proteins. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. The encoded protein is a molecular chaperone that stimulates the ATPase activity of Hsp70 heat-shock proteins in order to promote protein folding and prevent misfolded protein aggregation. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 241-340 of human DNAJB1/HSP40 (NP_006136.1).
Sequence	DKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
Gene ID
Swiss Prot
Synonyms	DNAJB1; HSPF1; Hdj1; Hsp40; RSPH16B; Sis1; dnaJ homolog subfamily B member 1; HSP40
Calculated MW	27kDa/38kDa
Observed MW	40kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 FC (intra) 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T, Mouse testis, C2C12, Mouse plasma(Low expression control), Rat testis
Cellular location	Cytoplasm, Nucleus, nucleolus.
Customer validation	WB(Gallus gallus)