Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | HSP40 Rabbit mAb |
---|---|
Catalog No. | A23957 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC62654 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 241-340 of human DNAJB1/HSP40 (NP_006136.1). |
---|---|
Sequence | DKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI |
Gene ID | |
Swiss Prot | |
Synonyms | DNAJB1; HSPF1; Hdj1; Hsp40; RSPH16B; Sis1; dnaJ homolog subfamily B member 1; HSP40 |
Calculated MW | 27kDa/38kDa |
Observed MW | 40kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T, Mouse testis, C2C12, Mouse plasma(Low expression control), Rat testis |
Cellular location | Cytoplasm, Nucleus, nucleolus. |
Customer validation | WB(Gallus gallus, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23957? Please let us know so that we can cite the reference in this datasheet.