제품 > 항체 > 단일클론항체(mAb)

ICAM-1/CD54 Rabbit mAb (A19300)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

ABclonal:Western blot - ICAM-1/CD54 Rabbit mAb (A19300)

Western blot analysis of lysates from A-549 cells, using ICAM-1/CD54 Rabbit mAb (A19300) at 1:1000 dilution.A-549 cells were treated by TNF-α (20 ng/mL) at 37℃ for 30 minutes.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

ABclonal:Immunohistochemistry - ICAM-1/CD54 Rabbit mAb (A19300)

Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using ICAM-1/CD54 Rabbit mAb (A19300) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using ICAM-1/CD54 Rabbit mAb (A19300) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using ICAM-1/CD54 Rabbit mAb (A19300) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using ICAM-1/CD54 Rabbit mAb (A19300) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human lung tissue using ICAM-1/CD54 Rabbit mAb (A19300) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using ICAM-1/CD54 Rabbit mAb (A19300) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using ICAM-1/CD54 Rabbit mAb (A19300) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using ICAM-1/CD54 Rabbit mAb (A19300) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Flow CytoMetry - ICAM-1/CD54 Rabbit mAb (A19300)

Flow cytometry:1X10^6 293F cells (negative control, left) and Raji cells (right) were surface-stained with ICAM-1/CD54 Rabbit mAb(A19300, 10 μg/mL, green line) or Rabbit IgG isotype control (AC042, 10 μg/mL, blue line), followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb(1:600 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).

Overview

Product name	ICAM-1/CD54 Rabbit mAb
Catalog No.	A19300
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0261

Background

This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ICAM-1/CD54 (P05362).
Sequence	MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQ
Gene ID
Swiss Prot
Synonyms	BB2; CD54; P3.58; MALA2; MyD10; ICAM-1/CD54
Calculated MW	58kDa
Observed MW	89kDa/100kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 FC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Flow Cytometry
Positive samples	A-549 treated by TNF-α
Cellular location	Membrane, Single-pass type I membrane protein
Customer validation	WB(Homo sapiens, Mus musculus) IHC(Homo sapiens)