제품 > 항체 > 단일클론항체(mAb)

ICOS/CD278 Rabbit mAb (A23995)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of lysates from wild type (WT) and CHO cells transfected with CD278 using CD278 Rabbit mAb (A23995) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunofluorescence - ICOS/CD278 Rabbit mAb (A23995)

Confocal imaging of CHO (Transfection, left) and CHO cells (negative control, right) using CD278 Rabbit mAb (A23995, dilution 1:200)(Red). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Flow CytoMetry - ICOS/CD278 Rabbit mAb (A23995)

Flow cytometry: 1X10^6 CHO cells (negative control, left) and CHO (Transfection, right) were surface-stained with CD278 Rabbit mAb(A23995, 2 μg/mL, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 2μg/mL, blue line), followed by ABflo™ 594-conjugated Goat Anti-Rabbit IgG (H+L) (1:500 dilution) staining.Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 CHO(Transfection) cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 2 μg/mL, left) or CD278 Rabbit mAb(A23995, 2 μg/mL, right).

Overview

Product name	ICOS/CD278 Rabbit mAb
Catalog No.	A23995
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62052

Background

Predicted to be involved in T cell costimulation; T cell tolerance induction; and cell-cell adhesion. Located in external side of plasma membrane. Is integral component of plasma membrane. Used to study common variable immunodeficiency. Human ortholog(s) of this gene implicated in celiac disease; common variable immunodeficiency; and immunoglobulin alpha deficiency. Orthologous to human ICOS (inducible T cell costimulator).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 21-142 of mouse ICOS/CD278(NP_059508.2).
Sequence	EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKL
Gene ID
Swiss Prot
Synonyms	H4; CCLP; AILIM; CRP-1; Ly115; ICOS/CD278
Calculated MW	22kDa
Observed MW	22-35kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:200 - 1:400 FC 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Flow Cytometry
Positive samples	Transfected CHO whole cell extracts.
Cellular location	Cell membrane.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ICOS/CD278 Rabbit mAb images

Western blot - ICOS/CD278 Rabbit mAb (A23995)

Immunofluorescence - ICOS/CD278 Rabbit mAb (A23995)

Confocal imaging of CHO (Transfection, left) and CHO cells (negative control, right) using CD278 Rabbit mAb (A23995, dilution 1:200)(Red). DAPI was used for nuclear staining (blue). Objective: 100x.

Flow CytoMetry - ICOS/CD278 Rabbit mAb (A23995)

Flow cytometry:1X10^6 CHO(Transfection) cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 2 μg/mL, left) or CD278 Rabbit mAb(A23995, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.