제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Mouse ICOS/CD278 mAb (A24252)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 CHO cells(negative control, left) and CHO (Transfection, right) were surface-stained with PE Rabbit anti-Mouse ICOS/CD278 mAb(A24252, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 CHO(Transfection) cells were surface-stained with PE Rabbit IgG isotype control (5 μl/Test, left) or PE Rabbit anti-Mouse ICOS/CD278 mAb(A24252, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Mouse ICOS/CD278 mAb
Catalog No.	A24252
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62050-PE

Background

Predicted to be involved in T cell costimulation; T cell tolerance induction; and cell-cell adhesion. Located in external side of plasma membrane. Is integral component of plasma membrane. Used to study common variable immunodeficiency. Human ortholog(s) of this gene implicated in celiac disease; common variable immunodeficiency; and immunoglobulin alpha deficiency. Orthologous to human ICOS (inducible T cell costimulator).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 21-142 of Mouse ICOS/CD278(NP_059508.2).
Sequence	EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKL
Gene ID
Swiss Prot
Synonyms	H4; CCLP; AILIM; CRP-1; Ly115
Calculated MW	22kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Secreted

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Mouse ICOS/CD278 mAb images

Flow CytoMetry - PE Rabbit anti-Mouse ICOS/CD278 mAb (A24252)

Flow cytometry:1X10^6 CHO(Transfection) cells were surface-stained with PE Rabbit IgG isotype control (5 μl/Test, left) or PE Rabbit anti-Mouse ICOS/CD278 mAb(A24252, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.