제품 > 항체 > 다중클론항체(pAb)

IFNAR1 Rabbit pAb (A18594)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using IFNAR1 Rabbit pAb (A18594) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - IFNAR1 Rabbit pAb (A18594)

Immunohistochemistry analysis of paraffin-embedded Mouse brain using IFNAR1 Rabbit pAb (A18594) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse spleen using IFNAR1 Rabbit pAb (A18594) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using IFNAR1 Rabbit pAb (A18594) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - IFNAR1 Rabbit pAb (A18594)

Immunofluorescence analysis of C6 cells using IFNAR1 Rabbit pAb (A18594) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using IFNAR1 Rabbit pAb (A18594) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using IFNAR1 Rabbit pAb (A18594) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	IFNAR1 Rabbit pAb
Catalog No.	A18594
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The protein belongs to the type II cytokine receptor family and functions as an antiviral factor.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 470-557 of human IFNAR1 (NP_000620.2).
Sequence	PSLKPSSSIDEYFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV
Gene ID
Swiss Prot
Synonyms	AVP; IFRC; IFNAR; IFNBR; IMD106; IFN-alpha-REC; IFNAR1
Calculated MW	64kDa
Observed MW	64kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse liver
Cellular location	Membrane, Single-pass type I membrane protein.
Customer validation	IHC(Homo sapiens) WB(Chlorocebus aethiops , Mus musculus) IF(Mus musculus)