제품 > 항체 > 다중클론항체(pAb)

RARRES2 Rabbit pAb (A6963)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using RARRES2 Rabbit pAb (A6963) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 15min.

ABclonal:Immunofluorescence - RARRES2 Rabbit pAb (A6963)

Immunofluorescence analysis of HeLa cells using RARRES2 Rabbit pAb (A6963) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using RARRES2 Rabbit pAb (A6963) at dilution of 1:25 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	RARRES2 Rabbit pAb
Catalog No.	A6963
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine and as an antimicrobial protein with activity against bacteria and fungi.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 17-163 of human RARRES2 (NP_002880.1).
Sequence	VGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS
Gene ID
Swiss Prot
Synonyms	TIG2; HP10433; RARRES2
Calculated MW	19kDa
Observed MW	18kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, BT-474, HeLa, Mouse liver
Cellular location	Secreted
Customer validation	WB(Homo sapiens) IHC(Mus musculus) IHC(Homo sapiens)