Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using ASC/TMS1 Rabbit mAb (A22046)at 1:12000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Jurkat
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Human liver tissue using ASC/TMS1 Rabbit mAb (A22046) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
| Product name | ASC/TMS1 Rabbit mAb |
|---|---|
| Catalog No. | A22046 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC54741 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 4-110 of human ASC/TMS1 (NP_037390.2). |
|---|---|
| Sequence | ARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKP |
| Gene ID | |
| Swiss Prot | |
| Synonyms | ASC; TMS; TMS1; CARD5; TMS-1; ASC/TMS1 |
| Calculated MW | 22kDa |
| Observed MW | 19kDa/22kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | THP-1, HL-60, U-937, Mouse thymus, Mouse spleen, Rat thymus |
| Cellular location | Cytoplasm, Endoplasmic reticulum, Mitochondrion, Nucleus. |
| Customer validation | WB(Mus musculus, Rattus norvegicus, Oryctolagus cuniculus) wb(Mus musculus) Other(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22046? Please let us know so that we can cite the reference in this datasheet.
