Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ASC/TMS1 Rabbit pAb |
---|---|
Catalog No. | A16672 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human ASC/TMS1 (NP_037390.2). |
---|---|
Sequence | MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQ |
Gene ID | |
Swiss Prot | |
Synonyms | ASC; TMS; TMS1; CARD5; TMS-1; ASC/TMS1 |
Calculated MW | 22kDa |
Observed MW | 19-25kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | HL-60, Mouse thymus, Rat spleen, Rat thymus |
Cellular location | Cytoplasm, Endoplasmic reticulum, Mitochondrion, Nucleus. |
Customer validation | WB(Mus musculus, Rattus norvegicus, Homo sapiens, Homo sapiens, Sus scrofa, Rana amurensis Boulenger, Rattus norvegicus) IF(Rattus norvegicus) IF(Mus musculus) IHC(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16672? Please let us know so that we can cite the reference in this datasheet.