Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | IFN-beta Rabbit mAb |
---|---|
Catalog No. | A22740 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC58590 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-182 of mouse IFN-beta (NP_034640.1) |
---|---|
Sequence | MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN |
Gene ID | |
Swiss Prot | |
Synonyms | Ifb; IFNB; If1da1; IFN-beta |
Calculated MW | 22kDa |
Observed MW | 63kDa (C-hFc&His taged Active Recombinant Mouse IFN-beta Protein),24kDa/26kDa(Endogenous) |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Recombinant Mouse IFN-beta Protein |
Cellular location | Secreted. |
Customer validation | WB(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22740? Please let us know so that we can cite the reference in this datasheet.