제품 > 항체 > 다중클론항체(pAb)

IFN-beta Rabbit pAb (A23651)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of Recombinant Mouse IFN-beta Protein (RP01076) using IFN-beta Rabbit pAb (A23651) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 10ng/5ng/1ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Immunofluorescence - IFN-beta Rabbit pAb (A23651)

Immunofluorescence analysis of HepG2 cells using IFN-beta Rabbit pAb (A23651) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded mouse small intestine using IFN-beta Rabbit pAb (A23651) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	IFN-beta Rabbit pAb
Catalog No.	A23651
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables cytokine activity and type I interferon receptor binding activity. Involved in B cell proliferation; cellular response to virus; and type I interferon signaling pathway. Acts upstream of or within several processes, including cellular response to organic cyclic compound; defense response to other organism; and negative regulation of osteoclast differentiation. Located in extracellular space. Is expressed in embryo and liver. Human ortholog(s) of this gene implicated in COVID-19. Orthologous to human IFNB1 (interferon beta 1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-182 of mouse IFN-beta (NP_034640.1)
Sequence	MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN
Gene ID
Swiss Prot
Synonyms	Ifb; IFNB; If1da1; IFN-beta
Calculated MW	22kDa
Observed MW	63kDa (C-hFc&His taged Active Recombinant Mouse IFN-beta Protein)，24kDa/26kDa(Endogenous)

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Recombinant Mouse IFN-beta Protein
Cellular location
Customer validation	IF(Homo sapiens)