Review (1)Publications (5) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | IKKα Rabbit mAb |
---|---|
Catalog No. | A19694 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0174 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IKKα (NP_001269.3). |
---|---|
Sequence | MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCHEIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSG |
Gene ID | |
Swiss Prot | |
Synonyms | BPS2; IKK1; IKKA; IKBKA; TCF16; NFKBIKA; IKK-alpha; IKKα |
Calculated MW | 85kDa |
Observed MW | 85kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | U-251MG, THP-1, Jurkat, HeLa, Mouse kidney, NIH/3T3 |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | (RPMI-8226、PC3、293T、HeLa、U2-OS) WB(Mus musculus , Other) FC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A19694? Please let us know so that we can cite the reference in this datasheet.