제품 > 항체 > 다중클론항체(pAb)

IKKε Rabbit pAb (A16470)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Immunoprecipitation analysis of 200 μg extracts of K-562 cells, using 3 μg IKKε antibody (A16470). Western blot was performed from the immunoprecipitate using IKKε antibody (A16470) at a dilution of 1:1000.

Overview

Product name	IKKε Rabbit pAb
Catalog No.	A16470
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

IKBKE is a noncanonical I-kappa-B (see MIM 164008) kinase (IKK) that is essential for regulating antiviral signaling pathways. IKBKE has also been identified as a breast cancer (MIM 114480) oncogene and is amplified and overexpressed in over 30% of breast carcinomas and breast cancer cell lines (Hutti et al., 2009 [PubMed 19481526]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 460-620 of human IKKε (NP_001180251.1).
Sequence	VARTSLLYLSSSLGTERFSSVAGTPEIQELKAAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSIQQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNH
Gene ID
Swiss Prot
Synonyms	IKKE; IKKI; IKK-E; IKK-i; IKKε
Calculated MW	80kDa
Observed MW	110kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	K-562
Cellular location	Cytoplasm, Nucleus, PML body
Customer validation	WB(Homo sapiens)