Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Product name | IL10 Rabbit mAb |
---|---|
Catalog No. | A12255 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0650 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL10 (P22301). |
---|---|
Sequence | MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAEN |
Gene ID | |
Swiss Prot | |
Synonyms | CSIF; TGIF; GVHDS; IL-10; IL10A; IL10 |
Calculated MW | 21kDa |
Observed MW | 18kDa |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | THP-1 treated by LPS and Brefeldin A, Mouse spleen, Rat thymus |
Cellular location | extracellular region, extracellular space. |
Customer validation | IF(Rattus norvegicus, Other, Homo sapiens, Mus musculus) IHC(Gallus gallus, Rattus norvegicus) WB(Mus musculus, Rattus norvegicus, Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A12255? Please let us know so that we can cite the reference in this datasheet.