제품 > 항체 > 단일클론항체(mAb)

IL-1RA Rabbit mAb (A23956)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates, using IL-1RA Rabbit mAb (A23956) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

Overview

Product name	IL-1RA Rabbit mAb
Catalog No.	A23956
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62499

Background

Predicted to enable cytokine receptor binding activity. Acts upstream of or within insulin secretion and lipid metabolic process. Located in extracellular region and vesicle. Human ortholog(s) of this gene implicated in several diseases, including autoimmune disease (multiple); eye disease (multiple); kidney failure (multiple); lung disease (multiple); and vascular disease (multiple). Orthologous to human IL1RN (interleukin 1 receptor antagonist).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 27-178 of mouse IL-1RA ( NP_001034790.1).
Sequence	PSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ
Gene ID
Swiss Prot
Synonyms	IL-1ra; F630041P17Rik
Calculated MW	20kDa
Observed MW	19kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	A-431
Cellular location	Extracellular, Secreted, Cytoplasm
Customer validation	WB(Mus musculus) ELISA(Mus musculus)