제품 > 항체 > 다중클론항체(pAb)

IL1RN Rabbit pAb (A21089)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using IL1RN Rabbit pAb (A21089) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunofluorescence - IL1RN Rabbit pAb (A21089)

Immunofluorescence analysis of NIH/3T3 cells using IL1RN Rabbit pAb (A21089) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	IL1RN Rabbit pAb
Catalog No.	A21089
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable cytokine receptor binding activity. Acts upstream of or within insulin secretion and lipid metabolic process. Located in extracellular region and vesicle. Human ortholog(s) of this gene implicated in several diseases, including autoimmune disease (multiple); eye disease (multiple); kidney failure (multiple); lung disease (multiple); and vascular disease (multiple). Orthologous to human IL1RN (interleukin 1 receptor antagonist).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 27-178 of mouse IL1RN (NP_001034790.1).
Sequence	RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ
Gene ID
Swiss Prot
Synonyms	IL-1ra; F630041P17Rik; IL1RN
Calculated MW	20kDa
Observed MW	18kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	A-431
Cellular location	cytoplasm, extracellular region, extracellular space.