Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Western blot analysis of Recombinant Mouse IL-1 beta Protein (RP01340), using IL1β Rabbit mAb (A22257) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 10ng/5ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
Western blot analysis of lysates from RAW 264.7 cells using IL1β Rabbit mAb (A22257) at 1:1000 dilution incubated overnight at 4℃. Raw264.7 cells were treated by LPS (1 μg/ml) at 37℃ for 8 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 30 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Confocal imaging of RAW 264.7 cells (treated with BFA and LPS) and RAW 264.7 cells (untreated) using IL1β Rabbit mAb (A22257, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.
| Product name | IL1β Rabbit mAb |
|---|---|
| Catalog No. | A22257 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC56180 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 118-269 of mouse IL1β (NP_032387.1). |
|---|---|
| Sequence | VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | Il-1b; IL-1beta; IL1β |
| Calculated MW | 31kDa |
| Observed MW | 19kDa/17/31kDa |
| Reactivity | Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | Recombinant Mouse IL-1 beta Protein, RAW 264.7 |
| Cellular location | cytosol, extracellular region, extracellular space, lysosome. |
| Customer validation | WB(Mus musculus, Homo sapiens) PCR(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22257? Please let us know so that we can cite the reference in this datasheet.
