제품 > 항체 > 단일클론항체(mAb)

IL23R Rabbit mAb (A25882)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293F cells (negative control, left) and 293F (Transfection, right) cells were surface-stained with IL23R Rabbit mAb (A25882, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293F(Transfection) cells were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or IL23R Rabbit mAb (A25882, 2 μg/mL, right), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining.

Overview

Product name	IL23R Rabbit mAb
Catalog No.	A25882
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC66641

Background

The protein encoded by this gene is a subunit of the receptor for IL23A/IL23. This protein pairs with the receptor molecule IL12RB1/IL12Rbeta1, and both are required for IL23A signaling. This protein associates constitutively with Janus kinase 2 (JAK2), and also binds to transcription activator STAT3 in a ligand-dependent manner.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 124-353 of human IL23R (NP_653302.2).
Sequence	PPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETINATVPKTIIYWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETGKRYWQPWSSLFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGD
Gene ID
Swiss Prot
Synonyms	PSORS7
Calculated MW	41kDa/43kDa/72kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein.