제품 > 항체 > 다중클론항체(pAb)

IMMT Rabbit pAb (A14107)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using IMMT antibody (A14107) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	IMMT Rabbit pAb
Catalog No.	A14107
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables RNA binding activity. Involved in cristae formation. Located in mitochondrial inner membrane. Part of MICOS complex.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 300-400 of human IMMT (NP_006830.2).
Sequence	EELEKMKSVIENAKKKEVAGAKPHITAAEGKLHNMIVDLDNVVKKVQAAQSEAKVVSQYHELVVQARDDFKRELDSITPEVLPGWKGMSVSDLADKLSTDD
Gene ID
Swiss Prot
Synonyms	HMP; P87; P89; PIG4; Mic60; PIG52; MINOS2; P87/89; MICOS60
Calculated MW	84kDa
Observed MW	84kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	SW480, SW620, NCI-H460, HepG2, Mouse spleen, Mouse testis
Cellular location	Mitochondrion, Mitochondrion inner membrane, Single-pass membrane protein