Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using IMMT Rabbit pAb (A2751) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of lysates from Mouse brain, using IMMT Rabbit pAb (A2751) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunohistochemistry analysis of IMMT in paraffin-embedded rat heart tissue using IMMT Rabbit pAb (A2751) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Product name | IMMT Rabbit pAb |
|---|---|
| Catalog No. | A2751 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-270 of human IMMT (NP_006830.2). |
|---|---|
| Sequence | ESKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKK |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HMP; P87; P89; PIG4; Mic60; PIG52; MINOS2; P87/89; MICOS60; IMMT |
| Calculated MW | 84kDa |
| Observed MW | 90kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | HT-29, 293T, A-549, Mouse brain |
| Cellular location | Mitochondrion, Mitochondrion inner membrane, Single-pass membrane protein |
| Customer validation | WB(Homo sapiens, Mus musculus) IP(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2751? Please let us know so that we can cite the reference in this datasheet.
_WB_01.jpg?t=1705994869 "ABclonal:Western blot - IMMT Rabbit pAb (A2751)")
_WB_02.jpg?t=1705994869 "ABclonal:Western blot - IMMT Rabbit pAb (A2751)")
