제품 > 항체 > 단일클론항체(mAb)

Mitofilin Rabbit mAb (A23530)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates, using Mitofilin Rabbit mAb (A23530) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - Mitofilin Rabbit mAb (A23530)

Immunohistochemistry analysis of paraffin-embedded Human kidney using Mitofilin Rabbit mAb (A23530) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Mitofilin Rabbit mAb (A23530) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunoprecipitation - Mitofilin Rabbit mAb (A23530)

Immunoprecipitation analysis of 300 μg extracts of 293F cells using 3 μg Mitofilin Rabbit mAb (A23530). Western blot was performed from the immunoprecipitate using Mitofilin Rabbit mAb (A23530) at a dilition of 1:10000.

Overview

Product name	Mitofilin Rabbit mAb
Catalog No.	A23530
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61198

Background

Enables RNA binding activity. Involved in cristae formation. Located in mitochondrial inner membrane. Part of MICOS complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 65-300 of human Mitofilin. (NP_006830.2).
Sequence	AKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLKAKE
Gene ID
Swiss Prot
Synonyms	HMP; P87; P89; PIG4; Mic60; PIG52; MINOS2; P87/89; MICOS60; Mitofilin
Calculated MW	84kDa
Observed MW	90kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa, Mouse brain
Cellular location	Mitochondrion, Mitochondrion inner membrane, Single-pass membrane protein