제품 > 항체 > 다중클론항체(pAb)

INADL Rabbit pAb (A12063)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from mouse brain, using INADL Rabbit pAb (A12063) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - INADL Rabbit pAb (A12063)

Immunohistochemistry analysis of INADL in paraffin-embedded Human colon tissue using INADL Rabbit pAb (A12063) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of INADL in paraffin-embedded Human liver tissue using INADL Rabbit pAb (A12063) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Overview

Product name	INADL Rabbit pAb
Catalog No.	A12063
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human INADL (NP_795352.2).
Sequence	MPENPATDKLQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHIPSDCSANFDFSRKGLLVFTDGSITNGNVHRPSN
Gene ID
Swiss Prot
Synonyms	Cipp; INADL; hINADL; InaD-like
Calculated MW	196kDa
Observed MW	170kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse brain
Cellular location	Apical cell membrane, Cell junction, Cell membrane, Cytoplasm, Peripheral membrane protein, perinuclear region, tight junction
Customer validation	WB(Homo sapiens, Mus musculus )