제품 > 항체 > 다중클론항체(pAb)

IRAK4 Rabbit pAb (A21779)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using IRAK4 Rabbit pAb (A21779) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer:3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - IRAK4 Rabbit pAb (A21779)

Immunofluorescence analysis of RAW264.7 cells using IRAK4 Rabbit pAb (A21779) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of THP-1 cells using IRAK4 Rabbit pAb (A21779) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	IRAK4 Rabbit pAb
Catalog No.	A21779
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human IRAK4 (NP_057207.2).
Sequence	MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVV
Gene ID
Swiss Prot
Synonyms	IPD1; IMD67; REN64; IRAK-4; NY-REN-64
Calculated MW	52kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, Mouse brain, Rat brain
Cellular location	Cytoplasm