제품 > 항체 > 단일클론항체(mAb)

ITPR3 Rabbit mAb (A23202)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates, using ITPR3 Rabbit mAb (A23202) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	ITPR3 Rabbit mAb
Catalog No.	A23202
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC59549

Background

This gene encodes a receptor for inositol 1, 4, 5-trisphosphate, a second messenger that mediates the release of intracellular calcium. The receptor contains a calcium channel at the C-terminus and the ligand-binding site at the N-terminus. Knockout studies in mice suggest that type 2 and type 3 inositol 1, 4, 5-trisphosphate receptors play a key role in exocrine secretion underlying energy metabolism and growth.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1630-1870 of human ITPR3. (NP_002215.2).
Sequence	EGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLKKTKYGDRGNQLRKMLLQNYLQNRKSTSRGDLPDPIGTGLDPDWSAIAATQCRLDKEGATKLVCDLITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQETKSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQSSEMGTSVLIM
Gene ID
Swiss Prot
Synonyms	IP3R; CMT1J; IP3R3; ITPR3
Calculated MW	304kDa
Observed MW	300kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:6000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	SW620, HEL(Negative control)
Cellular location	Endoplasmic reticulum membrane, Multi-pass membrane protein
Customer validation	WB(Sus scrofa) IF(Mus musculus)