제품 > 항체 > 다중클론항체(pAb)

Integrin alpha 5 (ITGA5/CD49e) Rabbit pAb (A6209)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Integrin alpha 5 (ITGA5/CD49e) antibody (A6209) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of extracts of various cell lines, using Integrin alpha 5 (ITGA5/CD49e) antibody (A6209) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 30s.

ABclonal:Immunofluorescence - Integrin alpha 5 (ITGA5/CD49e) Rabbit pAb (A6209)

Immunofluorescence analysis of Human placenta using Integrin alpha 5 (ITGA5/CD49e) antibody (A6209) at dilution of 1:100. Blue: DAPI for nuclear staining.

Review

Overview

Product name	Integrin alpha 5 (ITGA5/CD49e) Rabbit pAb
Catalog No.	A6209
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 5 subunit. This subunit associates with the beta 1 subunit to form a fibronectin receptor. This integrin may promote tumor invasion, and higher expression of this gene may be correlated with shorter survival time in lung cancer patients. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 750-1000 of human Integrin alpha 5 (ITGA5/CD49e) (NP_002196.4).
Sequence	TVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLW
Gene ID
Swiss Prot
Synonyms	FNRA; CD49e; VLA-5; VLA5A
Calculated MW	115kDa
Observed MW	135kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	A-549, NIH/3T3, HT-1080, Rat heart, Mouse heart
Cellular location	Membrane, Single-pass type I membrane protein
Customer validation	(HeLa cells) Other(Mus musculus) WB(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Integrin alpha 5 (ITGA5/CD49e) Rabbit pAb images

Western blot - Integrin alpha 5 (ITGA5/CD49e) Rabbit pAb (A6209)

Immunofluorescence - Integrin alpha 5 (ITGA5/CD49e) Rabbit pAb (A6209)

Immunofluorescence analysis of Human placenta using Integrin alpha 5 (ITGA5/CD49e) antibody (A6209) at dilution of 1:100. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.