제품 > 항체 > 단일클론항체(mAb)

Interferon alpha 1 (IFN-α1) Rabbit mAb (A21081)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of Recombinant Human IFN-alpha 1/13(Q114A) Protein (RP00011), using Interferon alpha 1 (IFN-α1) Rabbit mAb (A21081) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 10ng/5ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Overview

Product name	Interferon alpha 1 (IFN-α1) Rabbit mAb
Catalog No.	A21081
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC52133

Background

This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded cytokine is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. This cytokine is upregulated in preeclamptic placentas and is thought to be a mediator of preeclampsia.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-189 of human Interferon alpha 1 (IFN-α1) (NP_076918.1).
Sequence	CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
Gene ID
Swiss Prot
Synonyms	IFL; IFN; IFNA@; IFNA13; leIF D; IFN-ALPHA; IFN-alphaD; Interferon alpha 1 (IFN-α1)
Calculated MW	22kDa
Observed MW	18kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Recombinant Human IFNA1 Protein
Cellular location	Secreted.
Customer validation	WB(Sus scrofa)