제품 > 항체 > 다중클론항체(pAb)

KDM7A Rabbit pAb (A14692)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of T-47d, using KDM7A Rabbit pAb (A14692) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	KDM7A Rabbit pAb
Catalog No.	A14692
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables histone H3-methyl-lysine-9 demethylase activity and histone H3-tri/di-methyl-lysine-27 demethylase activity. Involved in histone H3-K27 demethylation; histone H3-K9 demethylation; and positive regulation of transcription, DNA-templated. Predicted to be located in nucleolus and nucleoplasm. Human ortholog(s) of this gene implicated in melanoma. Orthologous to human KDM7A (lysine demethylase 7A).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of mouse KDM7A (NP_001028602.2).
Sequence	WHRHDYTEVDDGSKPVQAGTRAFVKELRSRVFPSADEIIVKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPAFSVMDVERYVGGDKVIDVIDVARQ
Gene ID
Swiss Prot
Synonyms	Jhdm1d; mKIAA1718; A630082K20Rik
Calculated MW	106kDa
Observed MW	106kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	T-47d
Cellular location	Nucleus
Customer validation	WB(Homo sapiens, Mus musculus) IF(Mus musculus) ChIP(Mus musculus) CUT&Tag(Mus musculus)