제품 > 항체 > 단일클론항체(mAb)

[KD Validated] Ajuba Rabbit mAb (A22039)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of lysates from Rat lung using [KD Validated] Ajuba Rabbit mAb (A22039) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Western blot analysis of lysates from wild type (WT) and Ajuba knockdown (KD) HepG2 cells, using [KD Validated] Ajuba Rabbit mAb (A22039) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunoprecipitation - [KD Validated] Ajuba Rabbit mAb (A22039)

Immunoprecipitation analysis of 300 μg extracts of HepG2 cells using 3 μg Ajuba antibody (A22039). Western blot was performed from the immunoprecipitate using Ajuba (A22039) at a dilution of 1:10000.

Overview

Product name	[KD Validated] Ajuba Rabbit mAb
Catalog No.	A22039
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54979

Background

Enables alpha-catenin binding activity and transcription corepressor activity. Involved in several processes, including negative regulation of hippo signaling; positive regulation of gene silencing by miRNA; and regulation of cellular response to hypoxia. Acts upstream of or within gene silencing by miRNA and positive regulation of protein-containing complex assembly. Located in several cellular components, including Golgi apparatus; P-body; and nucleoplasm.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 201-290 of human Ajuba (NP_116265.1).
Sequence	PSAYPELHAALDRLYAQRPAGFGCQESRHSYPPALGSPGALAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDELTALLRLTVGT
Gene ID
Swiss Prot
Synonyms	JUB; [KD Validated] Ajuba
Calculated MW	57kDa
Observed MW	55kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:20000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HepG2, Rat lung
Cellular location	adherens junction, cell-cell junction, cytosol, Golgi apparatus, microtubule organizing center, nucleoplasm, nucleus, P-body, plasma membrane
Customer validation	Cell transfection(Homo sapiens)