제품 > 항체 > 다중클론항체(pAb)

[KO Validated] Ajuba Rabbit pAb (A21760)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of lysates from HepG2 cells, using [KO Validated] Ajuba Rabbit pAb (A21760) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of lysates from Rat kidney using [KO Validated] Ajuba Rabbit pAb (A21760) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Western blot analysis of lysates from wild type (WT) and AJUBA knockdown (KD) Hep G2 cells using [KO Validated] Ajuba Rabbit pAb (A21760) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	[KO Validated] Ajuba Rabbit pAb
Catalog No.	A21760
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables alpha-catenin binding activity and transcription corepressor activity. Involved in several processes, including negative regulation of hippo signaling; positive regulation of gene silencing by miRNA; and regulation of cellular response to hypoxia. Acts upstream of or within gene silencing by miRNA and positive regulation of protein-containing complex assembly. Located in several cellular components, including Golgi apparatus; P-body; and nucleoplasm.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 201-290 of human Ajuba (NP_116265.1).
Sequence	PSAYPELHAALDRLYAQRPAGFGCQESRHSYPPALGSPGALAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDELTALLRLTVGT
Gene ID
Swiss Prot
Synonyms	JUB; ba
Calculated MW	57kDa
Observed MW	55kDa/

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HepG2, Rat kidney, Rat kidney , Hep G2
Cellular location	adherens junction, cell-cell junction, cytosol, Golgi apparatus, microtubule organizing center, nucleoplasm, nucleus, P-body, plasma membrane.