Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Western blot analysis of lysates from wild type (WT) and CAT1 knockdown (KD) HeLa cells using [KD Validated] CAT1 Rabbit pAb (A25422) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 17 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
Western blot analysis of lysates from Mouse heart using [KD Validated] CAT1 Rabbit pAb (A25422) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:20s.
| Product name | [KD Validated] CAT1 Rabbit pAb |
|---|---|
| Catalog No. | A25422 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC7A1(NP_003036.1). |
|---|---|
| Sequence | VLGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIA |
| Gene ID | |
| Swiss Prot | |
| Synonyms | ERR; ATRC1; CAT-1; HCAT1; REC1L |
| Calculated MW | 68kDa |
| Observed MW | 70kDa |
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | Mouse heart, HeLa |
| Cellular location | Cell membrane, Multi-pass membrane protein. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
![ABclonal:Western blot - [KD Validated] CAT1 Rabbit pAb (A25422)](https://img.abclonal.com/abclonal-manage/Catalog/A25422/A25422_1.jpg?t=1729667570 "ABclonal:Western blot - [KD Validated] CAT1 Rabbit pAb (A25422)")
![ABclonal:Western blot - [KD Validated] CAT1 Rabbit pAb (A25422)](https://img.abclonal.com/abclonal-manage/Catalog/A25422/A25422_2.jpg?t=1729667570 "ABclonal:Western blot - [KD Validated] CAT1 Rabbit pAb (A25422)")
